DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Ae and Lcp65Af

DIOPT Version :10

Sequence 1:NP_649679.1 Gene:Ccp84Ae / 40821 FlyBaseID:FBgn0004779 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_477274.1 Gene:Lcp65Af / 45017 FlyBaseID:FBgn0020639 Length:100 Species:Drosophila melanogaster


Alignment Length:117 Identity:33/117 - (28%)
Similarity:50/117 - (42%) Gaps:25/117 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IVIALALFAVAHGAVLRTAAPVAVASAPVPVLAKTVELEEVDPHP-QYTYSYDVQDTLSGDNKGH 68
            :::.:|||              |:|.|.|.:|.     :|.|..| .:.|.|:..|..|....|.
  Fly     4 LIVFVALF--------------ALAVADVQILK-----QESDVGPVSFNYGYETSDGSSAQAAGQ 49

  Fly    69 VEERDGDV----VRGEYSLIDADGFKRTVTYTADSINGFNAVVRREPLAAVV 116
            ::....|.    |:|.||.:..||...::.||||. ||:.......|:|.||
  Fly    50 LKNVGTDEEALNVKGTYSFVADDGQTYSIAYTADE-NGYQPQGAHLPVAPVV 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AeNP_649679.1 Chitin_bind_4 51..103 CDD:459790 17/55 (31%)
Lcp65AfNP_477274.1 Chitin_bind_4 32..87 CDD:459790 17/55 (31%)

Return to query results.
Submit another query.