DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Ae and Ccp84Aa

DIOPT Version :9

Sequence 1:NP_649679.1 Gene:Ccp84Ae / 40821 FlyBaseID:FBgn0004779 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_649683.1 Gene:Ccp84Aa / 40825 FlyBaseID:FBgn0004783 Length:205 Species:Drosophila melanogaster


Alignment Length:219 Identity:115/219 - (52%)
Similarity:126/219 - (57%) Gaps:36/219 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAAKIVIALALFAVAHGAVLRTAAP---------VAVASAPVPVLAKTV--ELEEVDPHPQYTYS 54
            ||.|.|.|||..|||.......|||         ...|.|||.|..|.|  ..||.||||||.:|
  Fly     1 MAFKFVFALAFVAVASAGYAPIAAPQVYHAAPAVATYAHAPVAVAQKVVVKAAEEYDPHPQYRFS 65

  Fly    55 YDVQDTLSGDNKGHVEERDGDVVRGEYSLIDADGFKRTVTYTADSINGFNAVVRREPLAAVVAAE 119
            |.|.|.|:|||||.||||||||||||||||||||:||.|.||||.||||||||.||||...||..
  Fly    66 YGVDDKLTGDNKGQVEERDGDVVRGEYSLIDADGYKRIVQYTADPINGFNAVVNREPLVKAVAVA 130

  Fly   120 PLLKVAAPLVKAAPVAPIAPVAL---AAPAPIVRSAPVA-VAAP-LIKSAPLAVAAPFVRSAPLA 179
            |::|..     |||||..|..|:   ||||.:...|||| .||| ::|:.           ||:|
  Fly   131 PVVKTV-----AAPVAQYAAPAVAHYAAPAVVKTVAPVAHYAAPAVVKTV-----------APVA 179

  Fly   180 -VAAPAPVLRTAAYATPLRYTAPA 202
             .||||..   |.||.|..|.|||
  Fly   180 HYAAPAAY---ATYAAPTHYAAPA 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AeNP_649679.1 Chitin_bind_4 51..103 CDD:278791 40/51 (78%)
Ccp84AaNP_649683.1 Chitin_bind_4 62..114 CDD:278791 40/51 (78%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440166
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C9WU
Homologene 1 1.000 - - H43711
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D133302at33392
OrthoFinder 1 1.000 - - FOG0006710
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.