DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Ae and Ccp84Ad

DIOPT Version :9

Sequence 1:NP_649679.1 Gene:Ccp84Ae / 40821 FlyBaseID:FBgn0004779 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_649680.1 Gene:Ccp84Ad / 40822 FlyBaseID:FBgn0004780 Length:199 Species:Drosophila melanogaster


Alignment Length:219 Identity:114/219 - (52%)
Similarity:123/219 - (56%) Gaps:42/219 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAAKIVIALALFAVAHGAVL--------------RTAAPVAVASAPVPVLAKTVELEEVDPHPQY 51
            ||.|.:...||.|.|...||              ...||||||.|. |||||..  ||.||||||
  Fly     1 MAFKFIALFALIAAASAGVLPVQQVYHAAPAVATYAQAPVAVAHAQ-PVLAKAA--EEYDPHPQY 62

  Fly    52 TYSYDVQDTLSGDNKGHVEERDGDVVRGEYSLIDADGFKRTVTYTADSINGFNAVVRREPLAAVV 116
            .|:|||||:||||:|..||||||||||||||||||||:||||.||||.||||||||.||||...|
  Fly    63 KYAYDVQDSLSGDSKSQVEERDGDVVRGEYSLIDADGYKRTVQYTADPINGFNAVVNREPLVKAV 127

  Fly   117 AAEPLLKVAAPLVKAAPVAPIAPVAL---AAPAPIVRSAPVAVAAPLIKSAPLAVAAPFVRSAPL 178
            |..|::|..     |||||..|..|:   ||||.:...||||..|                 ||.
  Fly   128 AVAPVVKTV-----AAPVAHYAAPAVAHYAAPAVVKTVAPVAHYA-----------------APA 170

  Fly   179 AVAAPAPVLRTAAYATPLRYTAPA 202
            .|...|||...||.||...|.|||
  Fly   171 VVKTVAPVAHYAAPATYTSYAAPA 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AeNP_649679.1 Chitin_bind_4 51..103 CDD:278791 42/51 (82%)
Ccp84AdNP_649680.1 Chitin_bind_4 62..114 CDD:278791 42/51 (82%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440163
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C9WU
Homologene 1 1.000 - - H43711
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D133302at33392
OrthoFinder 1 1.000 - - FOG0006710
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.