DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Ae and Ccp84Af

DIOPT Version :9

Sequence 1:NP_649679.1 Gene:Ccp84Ae / 40821 FlyBaseID:FBgn0004779 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_649678.1 Gene:Ccp84Af / 40820 FlyBaseID:FBgn0004778 Length:151 Species:Drosophila melanogaster


Alignment Length:152 Identity:80/152 - (52%)
Similarity:94/152 - (61%) Gaps:20/152 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAAKIVIALALFAVAHGAVL--------------RTAAPVAVASAPVPVLAKTVELEEVDPHPQY 51
            ||.|....|||.:.|...||              ...||||||.|. |||.|..  ||.||||||
  Fly     1 MAFKFFAVLALISAASAGVLPVQQVYHAAPAVATYAQAPVAVAHAQ-PVLTKAT--EEYDPHPQY 62

  Fly    52 TYSYDVQDTLSGDNKGHVEERDGDVVRGEYSLIDADGFKRTVTYTADSINGFNAVVRREPLAAVV 116
            .::|||||:||||:|..|||||||||.|||||||:||:||.|.||:|.:|||||||.|.||..| 
  Fly    63 KFAYDVQDSLSGDSKSQVEERDGDVVHGEYSLIDSDGYKRIVQYTSDPVNGFNAVVNRVPLDHV- 126

  Fly   117 AAEPLLKVAAPLVKAAPVAPIA 138
              :.::|..||:..||...|:|
  Fly   127 --KTVVKTVAPVAVAAAPIPVA 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AeNP_649679.1 Chitin_bind_4 51..103 CDD:278791 36/51 (71%)
Ccp84AfNP_649678.1 Chitin_bind_4 62..114 CDD:278791 36/51 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440165
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C9WU
Homologene 1 1.000 - - H43711
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D133302at33392
OrthoFinder 1 1.000 - - FOG0006710
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.