DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Ae and Cpr78Cc

DIOPT Version :10

Sequence 1:NP_649679.1 Gene:Ccp84Ae / 40821 FlyBaseID:FBgn0004779 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_649300.1 Gene:Cpr78Cc / 40355 FlyBaseID:FBgn0037069 Length:119 Species:Drosophila melanogaster


Alignment Length:97 Identity:26/97 - (26%)
Similarity:43/97 - (44%) Gaps:11/97 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 EEVDP---HPQYTYSYDVQDTLSGDNKGHVEERDGDVVRGEYSLIDADGFKRTVTYTADSINGFN 104
            |:|:|   ...|.|:::..:.:.....|:|     :.:.|..|.|..:|...::||.||. |||.
  Fly    31 EDVNPADAEGNYQYAFETSNGIQAQEAGNV-----NGISGSSSYISPEGVPISLTYVADE-NGFQ 89

  Fly   105 AVVRREPLAAVVAAEPLLKVAAPLVKAAPVAP 136
            ......|.|..: .|.:|: |...:.|.|..|
  Fly    90 PQGDHLPTAPPI-PEAILR-ALEYIAAHPPQP 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AeNP_649679.1 Chitin_bind_4 51..103 CDD:459790 13/51 (25%)
Cpr78CcNP_649300.1 Chitin_bind_4 42..88 CDD:459790 13/51 (25%)

Return to query results.
Submit another query.