DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Ae and Cpr78Cb

DIOPT Version :10

Sequence 1:NP_649679.1 Gene:Ccp84Ae / 40821 FlyBaseID:FBgn0004779 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_649299.2 Gene:Cpr78Cb / 40353 FlyBaseID:FBgn0037068 Length:140 Species:Drosophila melanogaster


Alignment Length:33 Identity:12/33 - (36%)
Similarity:15/33 - (45%) Gaps:1/33 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 GEYSLIDADGFKRTVTYTADSINGFNAVVRREP 111
            |.||....:|......|.||.: ||:.|.|..|
  Fly    78 GIYSYTSPEGVPIETRYIADEL-GFHVVGRHLP 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AeNP_649679.1 Chitin_bind_4 51..103 CDD:459790 7/23 (30%)
Cpr78CbNP_649299.2 Chitin_bind_4 55..101 CDD:459790 7/23 (30%)

Return to query results.
Submit another query.