DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Ae and Cpr78Ca

DIOPT Version :10

Sequence 1:NP_649679.1 Gene:Ccp84Ae / 40821 FlyBaseID:FBgn0004779 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_649298.2 Gene:Cpr78Ca / 40352 FlyBaseID:FBgn0037067 Length:127 Species:Drosophila melanogaster


Alignment Length:118 Identity:34/118 - (28%)
Similarity:47/118 - (39%) Gaps:19/118 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KIVIALALFAVAHGAVLRTAAPVAVASAPVPVLAKTVELEEVDPHPQYTYSYDVQDTLSGDNKGH 68
            |||:.|.|..|......|..|         |.|.:|:......|.|...||::.|.|.....||.
  Fly     6 KIVVFLVLVLVQLIHCTRFTA---------PSLDRTIYYRNTPPDPFGHYSFEFQTTNGITTKGA 61

  Fly    69 VEERDGDVVRGEYSLIDADGFKRTVTYTADSINGFNAVVRREPLAAVVAAEPL 121
            ..| :|.|  |....:..:|...|.:|.||: ||:      :|....:.|.||
  Fly    62 GNE-NGAV--GVVQFVSPEGIPVTFSYVADA-NGY------QPTGDHIPAIPL 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AeNP_649679.1 Chitin_bind_4 51..103 CDD:459790 16/51 (31%)
Cpr78CaNP_649298.2 Chitin_bind_4 46..92 CDD:459790 16/49 (33%)

Return to query results.
Submit another query.