DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Ae and Cpr76Bd

DIOPT Version :10

Sequence 1:NP_649679.1 Gene:Ccp84Ae / 40821 FlyBaseID:FBgn0004779 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_001262052.1 Gene:Cpr76Bd / 40123 FlyBaseID:FBgn0036881 Length:1231 Species:Drosophila melanogaster


Alignment Length:108 Identity:51/108 - (47%)
Similarity:63/108 - (58%) Gaps:10/108 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LRTAAPVA----VASAPVP--VLAKTV---ELEEVDPHPQYTYSYDVQDTLSGDNKGHVEERDGD 75
            |.:.||||    :.||||.  .:.|.|   .||..|.||:|.:.|.|.|..:||||...||||||
  Fly  1116 LSSHAPVAATAYLKSAPVTQHAVLKVVPEKHLEHFDAHPRYAFEYAVNDPHTGDNKHQKEERDGD 1180

  Fly    76 VVRGEYSLIDADGFKRTVTYTADSINGFNA-VVRREPLAAVVA 117
            ||:|||||::.||..|||.|.||...||:| |:.......:||
  Fly  1181 VVKGEYSLVEPDGNVRTVKYYADWETGFHAEVINSRDQGKIVA 1223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AeNP_649679.1 Chitin_bind_4 51..103 CDD:459790 29/51 (57%)
Cpr76BdNP_001262052.1 2A1904 130..>270 CDD:273344
PRK07003 <456..>610 CDD:235906
Chitin_bind_4 1156..1208 CDD:459790 29/51 (57%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.