DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Ae and Cpr72Ea

DIOPT Version :9

Sequence 1:NP_649679.1 Gene:Ccp84Ae / 40821 FlyBaseID:FBgn0004779 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_648882.1 Gene:Cpr72Ea / 39814 FlyBaseID:FBgn0036617 Length:341 Species:Drosophila melanogaster


Alignment Length:115 Identity:36/115 - (31%)
Similarity:53/115 - (46%) Gaps:17/115 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VIALALFAVAHGAVL-----RTAAPVAVASAPVPVLAKTVELEEVDPHPQYTYSYDVQDTLSGDN 65
            ::.|...::|||..|     .||...||.:   |...:.:..:|:.   ||:|.|  .:.||  :
  Fly     5 LLLLGSLSLAHGLALYYPYAYTAEGSAVFT---PTQRQYIAKDELG---QYSYGY--SEPLS--S 59

  Fly    66 KGHVEERDGDVVRGEYSLIDADGFKRTVTYTADSINGFNAVVRREPLAAV 115
            |......|| :.:|.||..||.|..:||.|.||: .||:......|.|.|
  Fly    60 KQETRTLDG-ITQGYYSYRDAAGKLQTVNYVADN-KGFHVAATNLPKAKV 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AeNP_649679.1 Chitin_bind_4 51..103 CDD:278791 19/51 (37%)
Cpr72EaNP_648882.1 Chitin_bind_4 49..95 CDD:278791 19/51 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453173
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.