powered by:
Protein Alignment Ccp84Ae and CG13670
DIOPT Version :9
Sequence 1: | NP_649679.1 |
Gene: | Ccp84Ae / 40821 |
FlyBaseID: | FBgn0004779 |
Length: | 208 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_648207.1 |
Gene: | CG13670 / 38938 |
FlyBaseID: | FBgn0035873 |
Length: | 266 |
Species: | Drosophila melanogaster |
Alignment Length: | 59 |
Identity: | 28/59 - (47%) |
Similarity: | 38/59 - (64%) |
Gaps: | 0/59 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 49 PQYTYSYDVQDTLSGDNKGHVEERDGDVVRGEYSLIDADGFKRTVTYTADSINGFNAVV 107
|:|:::|.|:|..:...:...|.|:||.|||.||::|.||..|.|.||||..|||.|.|
Fly 101 PEYSFAYGVEDGKTRVLQNRKETRNGDEVRGVYSVVDPDGTLRVVKYTADDANGFQAEV 159
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1544103at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR12236 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
3 | 3.020 |
|
Return to query results.
Submit another query.