DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Ae and Cpr65Ea

DIOPT Version :10

Sequence 1:NP_649679.1 Gene:Ccp84Ae / 40821 FlyBaseID:FBgn0004779 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_648075.1 Gene:Cpr65Ea / 38773 FlyBaseID:FBgn0035735 Length:127 Species:Drosophila melanogaster


Alignment Length:150 Identity:35/150 - (23%)
Similarity:53/150 - (35%) Gaps:50/150 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KIVIALALFAVAHGAVLRTAAPVAVASAPVPVLAKTVELEEVDPHPQYTYSYDVQDTLSGDNKGH 68
            |:::.:|||..|..|.|..           ..:.|.:..::.|.    ||:||::.. ||.   .
  Fly     3 KLLLVVALFGCALAAPLND-----------DTITKFLANQDTDG----TYAYDIEQA-SGI---Q 48

  Fly    69 VEERD--GDVVRGEYSLIDADGFKRTVTYTADSINGFNAVVRREPLAAVVAAEPLLKVAAPLVKA 131
            ::|..  |....|.||.|..:|....|.||||.. ||:                           
  Fly    49 IKEEGLAGHEAHGSYSYISPEGIPVQVVYTADEF-GFH--------------------------- 85

  Fly   132 APVAPIAPVALAAPAPIVRS 151
             |.:.:.|.....|..|:||
  Fly    86 -PQSNLLPTPPPIPEEILRS 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AeNP_649679.1 Chitin_bind_4 51..103 CDD:459790 18/53 (34%)
Cpr65EaNP_648075.1 Chitin_bind_4 37..84 CDD:459790 17/51 (33%)

Return to query results.
Submit another query.