DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Ae and Cpr64Ac

DIOPT Version :9

Sequence 1:NP_649679.1 Gene:Ccp84Ae / 40821 FlyBaseID:FBgn0004779 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_647874.1 Gene:Cpr64Ac / 38510 FlyBaseID:FBgn0035512 Length:188 Species:Drosophila melanogaster


Alignment Length:118 Identity:58/118 - (49%)
Similarity:74/118 - (62%) Gaps:2/118 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LALFAVAHGAVLRTAAPVAVASAPVPVLAKTVELEEVDPHPQYTYSYDVQDTLSGDNKGHVEERD 73
            ||..|:::.|...:.|| .|.:|||.| ||....|..||:|||::||.|.|..:||:|...|...
  Fly    52 LAAPAISYAAPAISYAP-KVLAAPVAV-AKVAVAEPYDPNPQYSFSYGVTDHHTGDSKQQEETLV 114

  Fly    74 GDVVRGEYSLIDADGFKRTVTYTADSINGFNAVVRREPLAAVVAAEPLLKVAA 126
            ..||.|.|||.:.||..|.||||||.:|||||||.::.:|||..|:|.|.|||
  Fly   115 NGVVHGSYSLAEPDGTIRKVTYTADKVNGFNAVVEKKGVAAVAIAKPALAVAA 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AeNP_649679.1 Chitin_bind_4 51..103 CDD:278791 25/51 (49%)
Cpr64AcNP_647874.1 Chitin_bind_4 92..144 CDD:395303 25/51 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C9WU
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1544103at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.