DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Ae and Cpr64Aa

DIOPT Version :10

Sequence 1:NP_649679.1 Gene:Ccp84Ae / 40821 FlyBaseID:FBgn0004779 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_647872.1 Gene:Cpr64Aa / 38508 FlyBaseID:FBgn0035510 Length:192 Species:Drosophila melanogaster


Alignment Length:211 Identity:89/211 - (42%)
Similarity:113/211 - (53%) Gaps:33/211 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAAKIVIAL-ALFAVAHGAVL---RTAAPV-----AVASAPVPVLAKTVELEEVDPHPQYTYSYD 56
            ||.|:::.| ||.||:...|:   ..|.|.     |:|....|::||....|..||:||||:|||
  Fly     1 MAQKLILVLSALVAVSSAVVVPGPGLALPAYPSYPALAKVAAPLVAKVAGPEPYDPNPQYTFSYD 65

  Fly    57 VQDTLSGDNKGHVEERDGDVVRGEYSLIDADGFKRTVTYTADSINGFNAVVRREPLAAVVAAEPL 121
            |.|..:||.|...|.|.||||:|.||||:|||.:|.|.||||.::|||||||||  .|||.|   
  Fly    66 VHDGSTGDVKSQQETRSGDVVQGAYSLIEADGTRRIVEYTADPVHGFNAVVRRE--GAVVKA--- 125

  Fly   122 LKVAAPLVKAAPVAPIAPVALAAPAPIVRSAPVAVAAPLIKSAPLAVAAPFVRSAPLAVAAPA-- 184
                        |||:|.|  .||||::.::|:....|....| ||.|.|.:........|||  
  Fly   126 ------------VAPVAKV--LAPAPLLHASPLVAKVPAYGPA-LAPAYPALAHGYGPALAPAYG 175

  Fly   185 PVLRTAAY--ATPLRY 198
            |.|...|.  .:||.|
  Fly   176 PALPKLALPALSPLGY 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AeNP_649679.1 Chitin_bind_4 51..103 CDD:459790 30/51 (59%)
Cpr64AaNP_647872.1 Chitin_bind_4 60..112 CDD:459790 30/51 (59%)

Return to query results.
Submit another query.