DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Ae and Cpr64Aa

DIOPT Version :9

Sequence 1:NP_649679.1 Gene:Ccp84Ae / 40821 FlyBaseID:FBgn0004779 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_647872.1 Gene:Cpr64Aa / 38508 FlyBaseID:FBgn0035510 Length:192 Species:Drosophila melanogaster


Alignment Length:211 Identity:89/211 - (42%)
Similarity:113/211 - (53%) Gaps:33/211 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAAKIVIAL-ALFAVAHGAVL---RTAAPV-----AVASAPVPVLAKTVELEEVDPHPQYTYSYD 56
            ||.|:::.| ||.||:...|:   ..|.|.     |:|....|::||....|..||:||||:|||
  Fly     1 MAQKLILVLSALVAVSSAVVVPGPGLALPAYPSYPALAKVAAPLVAKVAGPEPYDPNPQYTFSYD 65

  Fly    57 VQDTLSGDNKGHVEERDGDVVRGEYSLIDADGFKRTVTYTADSINGFNAVVRREPLAAVVAAEPL 121
            |.|..:||.|...|.|.||||:|.||||:|||.:|.|.||||.::|||||||||  .|||.|   
  Fly    66 VHDGSTGDVKSQQETRSGDVVQGAYSLIEADGTRRIVEYTADPVHGFNAVVRRE--GAVVKA--- 125

  Fly   122 LKVAAPLVKAAPVAPIAPVALAAPAPIVRSAPVAVAAPLIKSAPLAVAAPFVRSAPLAVAAPA-- 184
                        |||:|.|  .||||::.::|:....|....| ||.|.|.:........|||  
  Fly   126 ------------VAPVAKV--LAPAPLLHASPLVAKVPAYGPA-LAPAYPALAHGYGPALAPAYG 175

  Fly   185 PVLRTAAY--ATPLRY 198
            |.|...|.  .:||.|
  Fly   176 PALPKLALPALSPLGY 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AeNP_649679.1 Chitin_bind_4 51..103 CDD:278791 30/51 (59%)
Cpr64AaNP_647872.1 Chitin_bind_4 60..112 CDD:278791 30/51 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C9WU
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D147941at6960
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.