DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Ae and Cpr56F

DIOPT Version :10

Sequence 1:NP_649679.1 Gene:Ccp84Ae / 40821 FlyBaseID:FBgn0004779 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_611470.1 Gene:Cpr56F / 37299 FlyBaseID:FBgn0034499 Length:217 Species:Drosophila melanogaster


Alignment Length:68 Identity:30/68 - (44%)
Similarity:42/68 - (61%) Gaps:2/68 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 EEVDPHPQYTYSYDVQDTLSGDNKGHVEERDGDVVRGEYSLIDADGFKRTVTYTADSINGFNAVV 107
            |:..| .:|.:.|||||..||::.||:|.||||:..|.|.::..||.|:.|.|.||. ||:...:
  Fly   121 EQYGP-AKYEFKYDVQDYESGNDFGHMESRDGDLAVGRYYVLLPDGRKQIVEYEADQ-NGYRPTI 183

  Fly   108 RRE 110
            |.|
  Fly   184 RYE 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AeNP_649679.1 Chitin_bind_4 51..103 CDD:459790 25/51 (49%)
Cpr56FNP_611470.1 Chitin_bind_4 128..179 CDD:459790 25/51 (49%)

Return to query results.
Submit another query.