DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Ae and Crys

DIOPT Version :9

Sequence 1:NP_649679.1 Gene:Ccp84Ae / 40821 FlyBaseID:FBgn0004779 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_001285854.1 Gene:Crys / 34604 FlyBaseID:FBgn0005664 Length:477 Species:Drosophila melanogaster


Alignment Length:143 Identity:50/143 - (34%)
Similarity:77/143 - (53%) Gaps:45/143 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IVIALALFA--VAHGAVLRTAAPVAVASAPVPV--LAKTVEL----------------------- 42
            :::.|:|..  ||:.|.||          |:.:  |||:..|                       
  Fly     6 LLLCLSLLTCNVANSAYLR----------PIDLNQLAKSSNLQQQQQQQLRGALNRDDNNDDDDA 60

  Fly    43 --------EEVDPHPQYTYSYDVQDTLSGDNKGHVEERDGDVVRGEYSLIDADGFKRTVTYTADS 99
                    |:.|..|||:::|||:|:|:||:|...|:||||:|:|:||||:.||.:|.|.||||.
  Fly    61 TTLAPNSNEDYDTRPQYSFAYDVRDSLTGDDKRQEEKRDGDLVKGQYSLIEPDGTRRIVEYTADD 125

  Fly   100 INGFNAVVRREPL 112
            ::||||:|.::.|
  Fly   126 VSGFNAIVSKQRL 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AeNP_649679.1 Chitin_bind_4 51..103 CDD:278791 28/51 (55%)
CrysNP_001285854.1 Chitin_bind_4 77..129 CDD:278791 28/51 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453127
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C9WU
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1544103at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.