DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Ae and Cpr23B

DIOPT Version :9

Sequence 1:NP_649679.1 Gene:Ccp84Ae / 40821 FlyBaseID:FBgn0004779 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_608718.1 Gene:Cpr23B / 33480 FlyBaseID:FBgn0031467 Length:302 Species:Drosophila melanogaster


Alignment Length:191 Identity:70/191 - (36%)
Similarity:90/191 - (47%) Gaps:57/191 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 VLRTAAPVAVAS-----APVPVL-----------------AKTVELE-----------------E 44
            :|:.||..|.|.     :|:|||                 .:||:.:                 |
  Fly    86 LLQNAASAANAESVLLPSPLPVLRHEQNSEVVSSTQQQQEQQTVQHQQSEPLVVSSVLRQHQEPE 150

  Fly    45 VDPHPQYTYSYDVQDTLSGDNKGHVEERDGDVVRGEYSLIDADGFKRTVTYTADSINGFNAVVRR 109
            |.|...|:::|.|.|..:||.|.|.|.|||.||||.|||||.||:|||||||||.::||||||.|
  Fly   151 VFPPASYSFNYAVNDASTGDIKEHSETRDGYVVRGFYSLIDPDGYKRTVTYTADDVHGFNAVVNR 215

  Fly   110 EPLAAVVAAEPLLKVAAPLVKAAPVAPIAPVALAAPAPIVRSAPVAVAAPLIKSAPLAVAA 170
            .|.|        ||        |.|.|:|.|  |.|.|.|.....:.:..:|:|:..|..|
  Fly   216 VPYA--------LK--------AVVVPVAQV--AQPTPFVARDERSKSVDVIRSSGAAAGA 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AeNP_649679.1 Chitin_bind_4 51..103 CDD:278791 32/51 (63%)
Cpr23BNP_608718.1 Chitin_bind_4 157..209 CDD:278791 32/51 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1544103at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.