DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Ae and LOC3290255

DIOPT Version :10

Sequence 1:NP_649679.1 Gene:Ccp84Ae / 40821 FlyBaseID:FBgn0004779 Length:208 Species:Drosophila melanogaster
Sequence 2:XP_565333.2 Gene:LOC3290255 / 3290255 VectorBaseID:AGAMI1_006467 Length:182 Species:Anopheles gambiae


Alignment Length:62 Identity:34/62 - (54%)
Similarity:44/62 - (70%) Gaps:0/62 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 HPQYTYSYDVQDTLSGDNKGHVEERDGDVVRGEYSLIDADGFKRTVTYTADSINGFNAVVRR 109
            :|:|.|.|.|||..:||:|...|.||||||:|.|:|.||||.||.|.|::|..:||.|.|:|
Mosquito    85 YPKYKYDYGVQDAHTGDHKSQWEIRDGDVVKGGYTLYDADGTKRVVEYSSDKHHGFQAHVKR 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AeNP_649679.1 Chitin_bind_4 51..103 CDD:459790 28/51 (55%)
LOC3290255XP_565333.2 Chitin_bind_4 88..140 CDD:459790 28/51 (55%)

Return to query results.
Submit another query.