DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Ae and LOC3290078

DIOPT Version :10

Sequence 1:NP_649679.1 Gene:Ccp84Ae / 40821 FlyBaseID:FBgn0004779 Length:208 Species:Drosophila melanogaster
Sequence 2:XP_556645.2 Gene:LOC3290078 / 3290078 VectorBaseID:AGAMI1_011744 Length:141 Species:Anopheles gambiae


Alignment Length:61 Identity:29/61 - (47%)
Similarity:41/61 - (67%) Gaps:0/61 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 HPQYTYSYDVQDTLSGDNKGHVEERDGDVVRGEYSLIDADGFKRTVTYTADSINGFNAVVR 108
            :|:|.:.|.|:|..:||:|...|.||||||:|||::.:.||....|.|.||..|||.|:|:
Mosquito    69 YPKYKFEYGVKDYHTGDHKSQWEVRDGDVVKGEYTVQEPDGSMSVVKYHADGKNGFEAIVK 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AeNP_649679.1 Chitin_bind_4 51..103 CDD:459790 24/51 (47%)
LOC3290078XP_556645.2 None

Return to query results.
Submit another query.