DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Ae and Cpr30F

DIOPT Version :9

Sequence 1:NP_649679.1 Gene:Ccp84Ae / 40821 FlyBaseID:FBgn0004779 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_723504.1 Gene:Cpr30F / 318997 FlyBaseID:FBgn0051876 Length:146 Species:Drosophila melanogaster


Alignment Length:161 Identity:69/161 - (42%)
Similarity:93/161 - (57%) Gaps:28/161 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LALFAVAHGAVLRTAAPVAVASAPV--PVLAKTVELEEVDPHPQYTYSYDVQDTLSGDNKGHVEE 71
            ::||.:..||......|:..:.|.:  |:| ||||: |...|  |.::|.|.|..:||.|...|.
  Fly     5 VSLFILGVGAAAAIELPIYHSPAAIVKPLL-KTVEV-EAPAH--YDFAYSVHDEHTGDIKSQTES 65

  Fly    72 RDGDVVRGEYSLIDADGFKRTVTYTADSINGFNAVVRREPLAAVVAAEPLLKVAAPLVKAAPVAP 136
            |.||.|:|:|:|:||||:.|||.||:|:.|||||||||:||...|            :||||:| 
  Fly    66 RKGDQVQGQYTLVDADGYLRTVDYTSDAHNGFNAVVRRDPLGQKV------------IKAAPIA- 117

  Fly   137 IAPVALAAPAPIVRSAPVAVAAP-LIKSAPL 166
                .|.||||:    |:|.||| |:..|.|
  Fly   118 ----KLLAPAPL----PLAYAAPKLLAPAKL 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AeNP_649679.1 Chitin_bind_4 51..103 CDD:278791 26/51 (51%)
Cpr30FNP_723504.1 Chitin_bind_4 45..97 CDD:395303 26/51 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453202
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C9WU
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.