DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Ae and Cpr49Aa

DIOPT Version :10

Sequence 1:NP_649679.1 Gene:Ccp84Ae / 40821 FlyBaseID:FBgn0004779 Length:208 Species:Drosophila melanogaster
Sequence 2:NP_001097285.1 Gene:Cpr49Aa / 246413 FlyBaseID:FBgn0050045 Length:144 Species:Drosophila melanogaster


Alignment Length:152 Identity:37/152 - (24%)
Similarity:64/152 - (42%) Gaps:35/152 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IVIALALFAVAHG-AVLRTAAPVAVASAPVPVLAKTVELEEVDPHPQYTYSYDVQDTLSGDNKGH 68
            :.||..|.::|.. ..:|..||    ..|:|::.:.   :||:....|.|.|:..:.::.:.:|:
  Fly     6 LFIAALLLSLAQARPQVRGQAP----GEPIPIIRQE---QEVNFDGSYKYLYETGNGINAEEEGY 63

  Fly    69 VE----ERDGDVVRGEYSLIDADGFKRTVTYTADSINGFNAVVRREPLAAVVAAEPLLKVAAPLV 129
            ::    :..|.|.:|.:|....:|....:||.||. |||      :|....:...|         
  Fly    64 LKNPGTDNAGQVAQGSFSYTSPEGIPIRITYLADE-NGF------QPQGDHLPTPP--------- 112

  Fly   130 KAAPVAPIAPVALA----APAP 147
               |:.|....|||    ||.|
  Fly   113 ---PIPPAIQKALAYLATAPPP 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AeNP_649679.1 Chitin_bind_4 51..103 CDD:459790 14/55 (25%)
Cpr49AaNP_001097285.1 Chitin_bind_4 46..101 CDD:459790 14/55 (25%)

Return to query results.
Submit another query.