DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Ae and LOC1277180

DIOPT Version :10

Sequence 1:NP_649679.1 Gene:Ccp84Ae / 40821 FlyBaseID:FBgn0004779 Length:208 Species:Drosophila melanogaster
Sequence 2:XP_316624.4 Gene:LOC1277180 / 1277180 VectorBaseID:AGAMI1_000285 Length:193 Species:Anopheles gambiae


Alignment Length:62 Identity:32/62 - (51%)
Similarity:43/62 - (69%) Gaps:0/62 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 HPQYTYSYDVQDTLSGDNKGHVEERDGDVVRGEYSLIDADGFKRTVTYTADSINGFNAVVRR 109
            ||.|.:.|.|:|..:||:|...|.||||||:|.|:|.:|||.:|.|.||:|..:||.|.|:|
Mosquito    97 HPSYKFEYGVKDPHTGDHKSQWEHRDGDVVKGAYTLHEADGTERVVEYTSDKHHGFQAHVKR 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AeNP_649679.1 Chitin_bind_4 51..103 CDD:459790 25/51 (49%)
LOC1277180XP_316624.4 None

Return to query results.
Submit another query.