DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Ae and LOC1270229

DIOPT Version :10

Sequence 1:NP_649679.1 Gene:Ccp84Ae / 40821 FlyBaseID:FBgn0004779 Length:208 Species:Drosophila melanogaster
Sequence 2:XP_308908.3 Gene:LOC1270229 / 1270229 VectorBaseID:AGAMI1_001941 Length:244 Species:Anopheles gambiae


Alignment Length:67 Identity:34/67 - (50%)
Similarity:47/67 - (70%) Gaps:0/67 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 EEVDPHPQYTYSYDVQDTLSGDNKGHVEERDGDVVRGEYSLIDADGFKRTVTYTADSINGFNAVV 107
            :|.:.:|:|::.|.|.|..:||:|...|.||||||:|.|.|.:|||..|.|.||:|..|||||||
Mosquito   132 DEYNAYPKYSFEYGVDDPHTGDHKKQWEFRDGDVVKGGYMLKEADGTTRVVEYTSDDHNGFNAVV 196

  Fly   108 RR 109
            ::
Mosquito   197 KK 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AeNP_649679.1 Chitin_bind_4 51..103 CDD:459790 26/51 (51%)
LOC1270229XP_308908.3 Chitin_bind_4 140..192 CDD:459790 26/51 (51%)

Return to query results.
Submit another query.