DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Af and Lcp65Af

DIOPT Version :10

Sequence 1:NP_649678.1 Gene:Ccp84Af / 40820 FlyBaseID:FBgn0004778 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_477274.1 Gene:Lcp65Af / 45017 FlyBaseID:FBgn0020639 Length:100 Species:Drosophila melanogaster


Alignment Length:110 Identity:31/110 - (28%)
Similarity:46/110 - (41%) Gaps:23/110 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 VATYAQAPVAVAHAQPVLTKATEEYDPHP-QYKFAYDVQDSLSGDSKSQVEERDGDV----VHGE 91
            ||.:|   :|||..|.:    .:|.|..| .:.:.|:..|..|..:..|::....|.    |.|.
  Fly     8 VALFA---LAVADVQIL----KQESDVGPVSFNYGYETSDGSSAQAAGQLKNVGTDEEALNVKGT 65

  Fly    92 YSLIDSDGYKRIVQYTSDPVNGFNAVVNRVPLDHVKTVVKTVAPV 136
            ||.:..||....:.||:|. ||:......:|          ||||
  Fly    66 YSFVADDGQTYSIAYTADE-NGYQPQGAHLP----------VAPV 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AfNP_649678.1 Chitin_bind_4 62..114 CDD:459790 15/55 (27%)
Lcp65AfNP_477274.1 Chitin_bind_4 32..87 CDD:459790 15/55 (27%)

Return to query results.
Submit another query.