DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Af and Ccp84Ab

DIOPT Version :10

Sequence 1:NP_649678.1 Gene:Ccp84Af / 40820 FlyBaseID:FBgn0004778 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_649682.1 Gene:Ccp84Ab / 40824 FlyBaseID:FBgn0004782 Length:221 Species:Drosophila melanogaster


Alignment Length:183 Identity:109/183 - (59%)
Similarity:122/183 - (66%) Gaps:37/183 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAFKFFAVLALISAASAGVLPV--QQVYHAAPAVATYAQAPVAVAHAQPVLTKATEEYDPHPQYK 63
            |||||...||.::.||||..|:  .|||||||||||||.|||||  ||.|:.||.|||||||||:
  Fly     1 MAFKFVFALAFVAVASAGYAPIAAPQVYHAAPAVATYAHAPVAV--AQKVVVKAAEEYDPHPQYR 63

  Fly    64 FAYDVQDSLSGDSKSQVEERDGDVVHGEYSLIDSDGYKRIVQYTSDPVNGFNAVVNRVPL----- 123
            |:|.|.|.|:||:|.||||||||||.|||||||:|||||.||||:||:|||||||||.||     
  Fly    64 FSYGVDDKLTGDNKGQVEERDGDVVRGEYSLIDADGYKRTVQYTADPINGFNAVVNREPLVKAVA 128

  Fly   124 --DHVKT--------------------VVKTVAPVAVAAAP------IPVAYH 148
              ..|||                    |||||||||..|||      .|||::
  Fly   129 VAPVVKTVAAPVAQYAAPAVAHYAAPAVVKTVAPVAHYAAPAVVKTVAPVAHY 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AfNP_649678.1 Chitin_bind_4 62..114 CDD:459790 38/51 (75%)
Ccp84AbNP_649682.1 Chitin_bind_4 62..114 CDD:459790 38/51 (75%)

Return to query results.
Submit another query.