DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Af and Cpr78Cb

DIOPT Version :10

Sequence 1:NP_649678.1 Gene:Ccp84Af / 40820 FlyBaseID:FBgn0004778 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_649299.2 Gene:Cpr78Cb / 40353 FlyBaseID:FBgn0037068 Length:140 Species:Drosophila melanogaster


Alignment Length:84 Identity:16/84 - (19%)
Similarity:32/84 - (38%) Gaps:18/84 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 DPHPQYKFAYDVQDSLSGDSKSQVEERDGDVVHGEYSLIDSDGYKRIVQYTSDPVNGFNAVVNRV 121
            |....:|:|:...:.:...:.....|     ..|.||....:|.....:|.:|.: ||:.|...:
  Fly    50 DDEGVFKYAFKTSNGIDVQAAGSPLE-----TIGIYSYTSPEGVPIETRYIADEL-GFHVVGRHL 108

  Fly   122 P------------LDHVKT 128
            |            |::::|
  Fly   109 PQPPPTPDYILRSLEYIRT 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AfNP_649678.1 Chitin_bind_4 62..114 CDD:459790 9/51 (18%)
Cpr78CbNP_649299.2 Chitin_bind_4 55..101 CDD:459790 9/51 (18%)

Return to query results.
Submit another query.