DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Af and Cpr78Ca

DIOPT Version :10

Sequence 1:NP_649678.1 Gene:Ccp84Af / 40820 FlyBaseID:FBgn0004778 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_649298.2 Gene:Cpr78Ca / 40352 FlyBaseID:FBgn0037067 Length:127 Species:Drosophila melanogaster


Alignment Length:119 Identity:23/119 - (19%)
Similarity:43/119 - (36%) Gaps:24/119 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 VLPVQQVYHAAPAVATYAQAPVAVAHAQPVLTKATEEYDPHPQYKFAYDVQDSLSGDSKSQVEER 83
            ||.:.|:.|.....|......:...:..|         ||...|.|.:...:.::  :|....| 
  Fly    12 VLVLVQLIHCTRFTAPSLDRTIYYRNTPP---------DPFGHYSFEFQTTNGIT--TKGAGNE- 64

  Fly    84 DGDVVHGEYSLIDSDGYKRIVQYTSDPVNGFNAVVNRVP---------LDHVKT 128
            :|.|  |....:..:|......|.:| .||:....:.:|         |::::|
  Fly    65 NGAV--GVVQFVSPEGIPVTFSYVAD-ANGYQPTGDHIPAIPLHVIRQLEYIRT 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AfNP_649678.1 Chitin_bind_4 62..114 CDD:459790 11/51 (22%)
Cpr78CaNP_649298.2 Chitin_bind_4 46..92 CDD:459790 11/51 (22%)

Return to query results.
Submit another query.