DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Af and Cpr72Ec

DIOPT Version :10

Sequence 1:NP_649678.1 Gene:Ccp84Af / 40820 FlyBaseID:FBgn0004778 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_648884.1 Gene:Cpr72Ec / 39816 FlyBaseID:FBgn0036619 Length:429 Species:Drosophila melanogaster


Alignment Length:138 Identity:37/138 - (26%)
Similarity:56/138 - (40%) Gaps:42/138 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VLALISAASAGVLPVQQVYHAAPAVATYAQAPVAVAHAQPVLTKATEEYDPHPQYKFAYDVQDSL 72
            :|||.|||.   ||               |.|          :...:|.|....: ::|..:|  
  Fly    12 LLALTSAAG---LP---------------QRP----------SSGYQEQDTARAF-YSYGYRD-- 45

  Fly    73 SGDSKSQVEERDGDVVHGEYSLIDSDGYKRIVQYTSDPVNGFNAVVNRVPLDHVKTVVKTVAPVA 137
            ...::::...||| ...|.||.:|:||..:.|:|.::.|.||.|..:..|          .|||.
  Fly    46 ENAARAEYSSRDG-TSRGFYSYVDADGKLQTVRYEANGVQGFKAEASNQP----------QAPVD 99

  Fly   138 VAAAPIPV 145
            ...||:||
  Fly   100 KGKAPLPV 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AfNP_649678.1 Chitin_bind_4 62..114 CDD:459790 14/51 (27%)
Cpr72EcNP_648884.1 Chitin_bind_4 39..82 CDD:459790 13/45 (29%)
Smc <107..>387 CDD:440809 1/1 (100%)

Return to query results.
Submit another query.