DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Af and Cpr66D

DIOPT Version :9

Sequence 1:NP_649678.1 Gene:Ccp84Af / 40820 FlyBaseID:FBgn0004778 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_729400.1 Gene:Cpr66D / 38990 FlyBaseID:FBgn0052029 Length:270 Species:Drosophila melanogaster


Alignment Length:148 Identity:52/148 - (35%)
Similarity:69/148 - (46%) Gaps:38/148 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 QQVYHAAPAVATYAQ--------APVAVAHAQP---------------VLTKA-----------T 53
            ||..:.||:|..|.|        .|.|.|..||               :|.|.           .
  Fly    84 QQQGYVAPSVRDYQQYQPQQAAYRPPAQAAPQPPRRIQQSSYQAPSTSILGKGQHKLSLQQQNEE 148

  Fly    54 EEY-DPHPQYKFAYDVQDSLSGDSKSQVEERDGDVVHGEYSLIDSDGYKRIVQYTSDPVNGFNAV 117
            ||| |.:..|:|.:||:|....:.:::.|.|||.|:.|.||::||||:.|.|:||:||..||.|.
  Fly   149 EEYDDQNSSYQFGFDVKDDEFTNYQNRKEIRDGSVIKGSYSVVDSDGFIRTVKYTADPKEGFKAE 213

  Fly   118 VNRVPLDHVKTVVKTVAP 135
            |.|.|.|   .|||...|
  Fly   214 VIREPTD---IVVKIPTP 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AfNP_649678.1 Chitin_bind_4 62..114 CDD:278791 23/51 (45%)
Cpr66DNP_729400.1 Chitin_bind_4 158..210 CDD:278791 23/51 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C9WU
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1544103at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.