DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Af and Cpr65Az

DIOPT Version :10

Sequence 1:NP_649678.1 Gene:Ccp84Af / 40820 FlyBaseID:FBgn0004778 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_648031.1 Gene:Cpr65Az / 38712 FlyBaseID:FBgn0035686 Length:239 Species:Drosophila melanogaster


Alignment Length:105 Identity:21/105 - (20%)
Similarity:39/105 - (37%) Gaps:25/105 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 PVLTKATEEYDPHPQYKFAYDVQDSLSGD-----SKSQVEERDGDVVHGEYSLIDSDGYKRIVQY 106
            |:: |...:.:....|.:.|:..:.:..:     ..:.||..:.....|.:|....:|.:..:.|
  Fly   115 PII-KLESKVNTDGSYMYEYETGNGIKAEEMGYLKNAGVEGAEAQTAEGSFSYTSPEGQEISLTY 178

  Fly   107 TSDPVNGFNAVVNRVPL-DHVKTVVKTVAPVAVAAAPIPV 145
            .:|. |||.      |. ||:.|           ..|||:
  Fly   179 IADE-NGFQ------PQGDHLPT-----------PPPIPI 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AfNP_649678.1 Chitin_bind_4 62..114 CDD:459790 10/56 (18%)
Cpr65AzNP_648031.1 Chitin_bind_4 129..185 CDD:459790 10/56 (18%)

Return to query results.
Submit another query.