DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Af and Cpr64Ad

DIOPT Version :9

Sequence 1:NP_649678.1 Gene:Ccp84Af / 40820 FlyBaseID:FBgn0004778 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_647875.1 Gene:Cpr64Ad / 38511 FlyBaseID:FBgn0035513 Length:247 Species:Drosophila melanogaster


Alignment Length:153 Identity:81/153 - (52%)
Similarity:94/153 - (61%) Gaps:11/153 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 AFKFFAVLALISAASAGVLPVQQVYHAAPAVATYAQAPVAVAHAQPVLTK-ATEEYDPHPQYKFA 65
            |..|.|.:|.::|..|..:........||..|..| ||||...|.||... |||..|.|||||||
  Fly    86 AAPFAAPVAPVAARLAAPVAAPLAAPVAPVAAPLA-APVAAPLAAPVAAPIATEIVDAHPQYKFA 149

  Fly    66 YDVQDSLSGDSKSQVEERDGDVVHGEYSLIDSDGYKRIVQYTSDPVNGFNAVVNR------VPLD 124
            |||||:|:||||:|.|.||||||.|.||||:.||.:|||.|.:|.:|||||||.:      .|:.
  Fly   150 YDVQDTLTGDSKTQEETRDGDVVRGSYSLIEPDGSRRIVSYYADSINGFNAVVQKDVPVAVAPVA 214

  Fly   125 HV--KTVVKTVAPVAVAAAPIPV 145
            .|  |||...|||| |||||.||
  Fly   215 PVLAKTVAAPVAPV-VAAAPAPV 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AfNP_649678.1 Chitin_bind_4 62..114 CDD:278791 35/51 (69%)
Cpr64AdNP_647875.1 Chitin_bind_4 146..198 CDD:306811 35/51 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C9WU
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1544103at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.