DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Af and Cpr64Ac

DIOPT Version :9

Sequence 1:NP_649678.1 Gene:Ccp84Af / 40820 FlyBaseID:FBgn0004778 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_647874.1 Gene:Cpr64Ac / 38510 FlyBaseID:FBgn0035512 Length:188 Species:Drosophila melanogaster


Alignment Length:139 Identity:63/139 - (45%)
Similarity:77/139 - (55%) Gaps:20/139 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 ISAASAGVLPVQQVYHAAPAVATYA----QAPVAVAHAQPVLTKATEEYDPHPQYKFAYDVQDSL 72
            ||.|:..:|....:.:||||: :||    .||||||.     ....|.|||:|||.|:|.|.|..
  Fly    44 ISYAAPKLLAAPAISYAAPAI-SYAPKVLAAPVAVAK-----VAVAEPYDPNPQYSFSYGVTDHH 102

  Fly    73 SGDSKSQVEERDGDVVHGEYSLIDSDGYKRIVQYTSDPVNGFNAVVNRVPLDHVKTVVKTVAPVA 137
            :||||.|.|.....||||.|||.:.||..|.|.||:|.||||||||.:          |.||.||
  Fly   103 TGDSKQQEETLVNGVVHGSYSLAEPDGTIRKVTYTADKVNGFNAVVEK----------KGVAAVA 157

  Fly   138 VAAAPIPVA 146
            :|...:.||
  Fly   158 IAKPALAVA 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AfNP_649678.1 Chitin_bind_4 62..114 CDD:278791 27/51 (53%)
Cpr64AcNP_647874.1 Chitin_bind_4 92..144 CDD:395303 27/51 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C9WU
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1544103at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.