DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Af and Cpr64Ac

DIOPT Version :10

Sequence 1:NP_649678.1 Gene:Ccp84Af / 40820 FlyBaseID:FBgn0004778 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_647874.1 Gene:Cpr64Ac / 38510 FlyBaseID:FBgn0035512 Length:188 Species:Drosophila melanogaster


Alignment Length:139 Identity:63/139 - (45%)
Similarity:77/139 - (55%) Gaps:20/139 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 ISAASAGVLPVQQVYHAAPAVATYA----QAPVAVAHAQPVLTKATEEYDPHPQYKFAYDVQDSL 72
            ||.|:..:|....:.:||||: :||    .||||||.     ....|.|||:|||.|:|.|.|..
  Fly    44 ISYAAPKLLAAPAISYAAPAI-SYAPKVLAAPVAVAK-----VAVAEPYDPNPQYSFSYGVTDHH 102

  Fly    73 SGDSKSQVEERDGDVVHGEYSLIDSDGYKRIVQYTSDPVNGFNAVVNRVPLDHVKTVVKTVAPVA 137
            :||||.|.|.....||||.|||.:.||..|.|.||:|.||||||||.:          |.||.||
  Fly   103 TGDSKQQEETLVNGVVHGSYSLAEPDGTIRKVTYTADKVNGFNAVVEK----------KGVAAVA 157

  Fly   138 VAAAPIPVA 146
            :|...:.||
  Fly   158 IAKPALAVA 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AfNP_649678.1 Chitin_bind_4 62..114 CDD:459790 27/51 (53%)
Cpr64AcNP_647874.1 Chitin_bind_4 92..144 CDD:459790 27/51 (53%)

Return to query results.
Submit another query.