DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Af and Cpr57A

DIOPT Version :10

Sequence 1:NP_649678.1 Gene:Ccp84Af / 40820 FlyBaseID:FBgn0004778 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_611489.1 Gene:Cpr57A / 37319 FlyBaseID:FBgn0034517 Length:184 Species:Drosophila melanogaster


Alignment Length:125 Identity:33/125 - (26%)
Similarity:47/125 - (37%) Gaps:28/125 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 VAVAHAQPVLTKATEEYDPHPQYKFAYDVQDSLSGDSKSQVEERDGD-VVHGEYSLIDSDGYKRI 103
            ||.|....::|  .|...|...|.|:|....:.....:...|..||. |:.|.:|.:|.....|.
  Fly    12 VAAADVSHLVT--PEPKVPASPYVFSYQAGRAPGHVDRQHTEVSDGSGVIRGAFSYVDPKNQVRT 74

  Fly   104 VQYTSDPVNGFN---------------------AVVNRVPLDHVKTVVKTVAPVAVAAAP 142
            |||.:|. :||:                     |..||:..:|..   .|...||:|.||
  Fly    75 VQYVADE-HGFHPQLSHKLEDSAAVQAAKQRHFAAYNRIAQEHAN---HTPGQVALANAP 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AfNP_649678.1 Chitin_bind_4 62..114 CDD:459790 15/52 (29%)
Cpr57ANP_611489.1 Chitin_bind_4 32..84 CDD:459790 15/52 (29%)

Return to query results.
Submit another query.