DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Af and Cpr51A

DIOPT Version :10

Sequence 1:NP_649678.1 Gene:Ccp84Af / 40820 FlyBaseID:FBgn0004778 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_610968.1 Gene:Cpr51A / 36613 FlyBaseID:FBgn0033942 Length:144 Species:Drosophila melanogaster


Alignment Length:129 Identity:35/129 - (27%)
Similarity:58/129 - (44%) Gaps:28/129 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 FKFFAVLALISAASAGVLPVQQVYHAAPAVATYAQAPVAVAHAQPVLTKATEEY-DPHPQYKFAY 66
            :||..:.:|:.|......|.|:                  :.|:.:..:..|:| :.:.||.|..
  Fly     2 YKFVLIASLLVALCMAAPPRQE------------------SEAERIEREEYEKYQNENAQYSFNS 48

  Fly    67 DVQDSLSGDSKSQVEERDGDVVHGEYSLIDSDGY-KRIVQYTSDPVNGFNAVVNRVPLDHVKTV 129
            .|.|.::....|:.|||:|..|.|.||..  ||: ||.|:|.:|. :|:     ||..|.::.|
  Fly    49 SVDDKINDGQISRNEEREGGTVRGSYSYF--DGFVKRRVEYIADK-DGY-----RVLKDEIEDV 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AfNP_649678.1 Chitin_bind_4 62..114 CDD:459790 20/52 (38%)
Cpr51ANP_610968.1 Chitin_bind_4 44..94 CDD:459790 20/52 (38%)

Return to query results.
Submit another query.