DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Af and Cpr50Cb

DIOPT Version :9

Sequence 1:NP_649678.1 Gene:Ccp84Af / 40820 FlyBaseID:FBgn0004778 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_610901.1 Gene:Cpr50Cb / 36525 FlyBaseID:FBgn0033869 Length:178 Species:Drosophila melanogaster


Alignment Length:162 Identity:44/162 - (27%)
Similarity:61/162 - (37%) Gaps:59/162 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAFKFFAVLALISAASAGVLPVQQVYHAAPAVATYAQ-APVAVAHAQPVLTKATEEYD------- 57
            |:||.|.:|:|..||.:..              .||| ||.:.|:..|  ||...:|.       
  Fly     2 MSFKSFVLLSLSLAAISAY--------------AYAQIAPGSNAYLPP--TKNGYDYSEPKTPFK 50

  Fly    58 -----------PHP------------------------QYKFAYDVQDSLSGDSKSQVEERDGDV 87
                       |.|                        .|.|.|.|||..:.:..:.....||||
  Fly    51 PGPPGRPAAPGPRPPAPPGTPRNIPGQPGDDHVHVPGMPYDFEYAVQDPETANDYAHKASSDGDV 115

  Fly    88 VHGEYSLIDSDGYKRIVQYTSDPVNGFNAVVN 119
            |.|||.:...||..:||:||:|...|::|.|:
  Fly   116 VTGEYRVQMPDGRTQIVRYTADWKTGYHADVS 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AfNP_649678.1 Chitin_bind_4 62..114 CDD:278791 21/51 (41%)
Cpr50CbNP_610901.1 Chitin_bind_4 90..142 CDD:278791 21/51 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.