DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Af and Cpr50Cb

DIOPT Version :10

Sequence 1:NP_649678.1 Gene:Ccp84Af / 40820 FlyBaseID:FBgn0004778 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_610901.1 Gene:Cpr50Cb / 36525 FlyBaseID:FBgn0033869 Length:178 Species:Drosophila melanogaster


Alignment Length:162 Identity:44/162 - (27%)
Similarity:61/162 - (37%) Gaps:59/162 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAFKFFAVLALISAASAGVLPVQQVYHAAPAVATYAQ-APVAVAHAQPVLTKATEEYD------- 57
            |:||.|.:|:|..||.:..              .||| ||.:.|:..|  ||...:|.       
  Fly     2 MSFKSFVLLSLSLAAISAY--------------AYAQIAPGSNAYLPP--TKNGYDYSEPKTPFK 50

  Fly    58 -----------PHP------------------------QYKFAYDVQDSLSGDSKSQVEERDGDV 87
                       |.|                        .|.|.|.|||..:.:..:.....||||
  Fly    51 PGPPGRPAAPGPRPPAPPGTPRNIPGQPGDDHVHVPGMPYDFEYAVQDPETANDYAHKASSDGDV 115

  Fly    88 VHGEYSLIDSDGYKRIVQYTSDPVNGFNAVVN 119
            |.|||.:...||..:||:||:|...|::|.|:
  Fly   116 VTGEYRVQMPDGRTQIVRYTADWKTGYHADVS 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AfNP_649678.1 Chitin_bind_4 62..114 CDD:459790 21/51 (41%)
Cpr50CbNP_610901.1 Chitin_bind_4 90..142 CDD:459790 21/51 (41%)

Return to query results.
Submit another query.