DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Af and Cpr49Af

DIOPT Version :10

Sequence 1:NP_649678.1 Gene:Ccp84Af / 40820 FlyBaseID:FBgn0004778 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_610775.1 Gene:Cpr49Af / 36352 FlyBaseID:FBgn0033729 Length:126 Species:Drosophila melanogaster


Alignment Length:123 Identity:36/123 - (29%)
Similarity:62/123 - (50%) Gaps:14/123 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 VATYAQAPVAVAHAQPVLTKATEEYDPHPQYKFAYDVQD----SLSGDSKSQVEERDGDVVHGEY 92
            :|.:..|..|..:..|:..::..||  :.:|.:.|:::|    :..|..||...:.:|:.|:|:|
  Fly     7 IALFVVAASATDNDDPISQESNVEY--NGKYHYHYELKDGSKATQDGVLKSVNADHNGESVNGKY 69

  Fly    93 SLIDSDGYKRIVQYTSDPVNGFNAVVNRVPLDHVKTVVKTVAPVAVAAAPIPVAYHQH 150
            |.:..||...:|.||:|. ||:.||.     ||:.|...|  ||:|..|...:..|.:
  Fly    70 SFVADDGKTYVVSYTADE-NGYLAVG-----DHLPTPPPT--PVSVLKALEYIRLHPY 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AfNP_649678.1 Chitin_bind_4 62..114 CDD:459790 18/55 (33%)
Cpr49AfNP_610775.1 Chitin_bind_4 35..90 CDD:459790 18/55 (33%)

Return to query results.
Submit another query.