DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Af and Lcp2

DIOPT Version :10

Sequence 1:NP_649678.1 Gene:Ccp84Af / 40820 FlyBaseID:FBgn0004778 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_476620.1 Gene:Lcp2 / 35818 FlyBaseID:FBgn0002533 Length:126 Species:Drosophila melanogaster


Alignment Length:166 Identity:36/166 - (21%)
Similarity:64/166 - (38%) Gaps:58/166 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 FKFFAVLALISAASAGVLPVQQVYHAAPAVATYAQAPVAVA---HAQPVLTKA----TEEYDPHP 60
            |||..:||::..|:                   |.|||:.:   ||. ||:::    .:.:|  .
  Fly     2 FKFVMILAVVGVAT-------------------ALAPVSRSDDVHAD-VLSRSDDVRADGFD--S 44

  Fly    61 QYKFAYDVQDSLSGDSKSQVEERDGDVVHGEYSLIDSDGYKRIVQYTSDPVNGFNAVVNRVPLDH 125
            ....:..::.:.|||:...        :||.:..|..:|....|:|.::. ||:......:|   
  Fly    45 SLHTSNGIEQAASGDAHGN--------IHGNFGWISPEGEHVEVKYVANE-NGYQPSGAWIP--- 97

  Fly   126 VKTVVKTVAPV--AVAAA--------PIPVAYHQHH 151
                  |..|:  |:|.|        |.| .:.:||
  Fly    98 ------TPPPIPEAIARAVAWLESHPPAP-EHPRHH 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AfNP_649678.1 Chitin_bind_4 62..114 CDD:459790 10/51 (20%)
Lcp2NP_476620.1 Chitin_bind_4 42..89 CDD:459790 11/57 (19%)

Return to query results.
Submit another query.