DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Af and Lcp1

DIOPT Version :10

Sequence 1:NP_649678.1 Gene:Ccp84Af / 40820 FlyBaseID:FBgn0004778 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_476619.1 Gene:Lcp1 / 35817 FlyBaseID:FBgn0002531 Length:130 Species:Drosophila melanogaster


Alignment Length:166 Identity:36/166 - (21%)
Similarity:58/166 - (34%) Gaps:54/166 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 FKFFAVLALISAASAGVLPVQQVYHAAPAVATYAQAPVAVAHAQPVLTKATEEYDPHPQYKFAYD 67
            |||..:.|::..|.|.           |.|      |.::..::.|......:.|         |
  Fly     2 FKFVMICAVLGLAVAN-----------PPV------PHSLGRSEDVHADVLSQSD---------D 40

  Fly    68 VQ----DSLSGDSKSQVEERDGDV---VHGEYSLIDSDGYKRIVQYTSDPVNGFNAVVNRVPLDH 125
            |:    ||....|....:...||.   :||.:..|..:|....|:|.::. ||:......:|   
  Fly    41 VRADGFDSSLHTSNGIEQAASGDAHGNIHGNFGWISPEGEHVEVKYVANE-NGYQPSGAWIP--- 101

  Fly   126 VKTVVKTVAPV--AVAAA--------PIPVAYHQHH 151
                  |..|:  |:|.|        |.| .:.:||
  Fly   102 ------TPPPIPEAIARAVAWLESHPPAP-EHPRHH 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AfNP_649678.1 Chitin_bind_4 62..114 CDD:459790 14/58 (24%)
Lcp1NP_476619.1 Chitin_bind_4 46..93 CDD:459790 12/47 (26%)

Return to query results.
Submit another query.