DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Af and Cpr35B

DIOPT Version :9

Sequence 1:NP_649678.1 Gene:Ccp84Af / 40820 FlyBaseID:FBgn0004778 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_609713.1 Gene:Cpr35B / 34846 FlyBaseID:FBgn0028871 Length:218 Species:Drosophila melanogaster


Alignment Length:143 Identity:52/143 - (36%)
Similarity:66/143 - (46%) Gaps:25/143 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAFKFFAVLALISAASAGVLPVQQVYHAAPAVATYAQAPVAVAHAQPVLTK-------------- 51
            ||.|||...||::.|:....|.....|       :.....|.:||...||.              
  Fly     1 MAQKFFIAFALLAIAAIRAAPFHGHEH-------HGHHGGATSHASVHLTSHDDHHEEHHGHHHD 58

  Fly    52 ---ATEEYDPHPQYKFAYDVQDSLSGDSKSQVEERDGDVVHGEYSLIDSDGYKRIVQYTSDPVNG 113
               ..:.:|.|.:|.|.|.|:|..:||.|||.|.|.|..|.|.|.|||:||:||.|.||:|...|
  Fly    59 HHGHDDHHDSHAEYDFQYGVKDQKTGDVKSQSESRHGHTVTGHYELIDADGHKRTVHYTADKHKG 123

  Fly   114 FNAVVNRVPL-DH 125
            |.|.|:|..| ||
  Fly   124 FEAHVHREKLHDH 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AfNP_649678.1 Chitin_bind_4 62..114 CDD:278791 27/51 (53%)
Cpr35BNP_609713.1 Chitin_bind_4 72..124 CDD:278791 27/51 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453229
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C9WU
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.