DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Af and Pcp

DIOPT Version :10

Sequence 1:NP_649678.1 Gene:Ccp84Af / 40820 FlyBaseID:FBgn0004778 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_476673.1 Gene:Pcp / 33985 FlyBaseID:FBgn0003046 Length:184 Species:Drosophila melanogaster


Alignment Length:77 Identity:18/77 - (23%)
Similarity:33/77 - (42%) Gaps:14/77 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 QYKFAYDVQDSLSGDSKSQVEERDGDVVHGEYSLIDSDGYKRIVQYTSDPVNGFNAVVNRVP--- 122
            :|::||:..:.:|...    |...|..|.|..|....:|....|.|.:|.. |::.|...:|   
  Fly    44 KYRYAYETSNGISASQ----EGLGGVAVQGGSSYTSPEGEVISVNYVADEF-GYHPVGAHIPQVP 103

  Fly   123 ------LDHVKT 128
                  |::::|
  Fly   104 DYILRSLEYIRT 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AfNP_649678.1 Chitin_bind_4 62..114 CDD:459790 13/51 (25%)
PcpNP_476673.1 Chitin_bind_4 45..92 CDD:459790 13/51 (25%)

Return to query results.
Submit another query.