DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Af and LOC3290077

DIOPT Version :10

Sequence 1:NP_649678.1 Gene:Ccp84Af / 40820 FlyBaseID:FBgn0004778 Length:151 Species:Drosophila melanogaster
Sequence 2:XP_556644.2 Gene:LOC3290077 / 3290077 VectorBaseID:AGAMI1_006388 Length:168 Species:Anopheles gambiae


Alignment Length:68 Identity:37/68 - (54%)
Similarity:48/68 - (70%) Gaps:0/68 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 EEYDPHPQYKFAYDVQDSLSGDSKSQVEERDGDVVHGEYSLIDSDGYKRIVQYTSDPVNGFNAVV 118
            ::|..:|:|||.|.|:|..:||.|||.|.||||||.|||:|.:.||..|||:|.:|..|||.|||
Mosquito    61 KDYYAYPKYKFEYGVKDYHTGDHKSQWEVRDGDVVKGEYTLDEPDGSTRIVKYHADSKNGFEAVV 125

  Fly   119 NRV 121
            ..:
Mosquito   126 KNI 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AfNP_649678.1 Chitin_bind_4 62..114 CDD:459790 30/51 (59%)
LOC3290077XP_556644.2 None

Return to query results.
Submit another query.