DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Af and Cpr11B

DIOPT Version :10

Sequence 1:NP_649678.1 Gene:Ccp84Af / 40820 FlyBaseID:FBgn0004778 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_572807.1 Gene:Cpr11B / 32203 FlyBaseID:FBgn0030398 Length:197 Species:Drosophila melanogaster


Alignment Length:159 Identity:44/159 - (27%)
Similarity:59/159 - (37%) Gaps:39/159 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FAVLALISAASAGVLPVQQV----YHAAPAVATYAQAPVAVAHA-----------QPVLTKATEE 55
            |:...|....|...||..|.    ||   .|:...||.....|:           ||.:.....:
  Fly    15 FSSAILAGRLSQRYLPTPQASQLHYH---GVSGQGQARPGAGHSFGGGSSYQRQQQPQIPIVRSD 76

  Fly    56 Y--DPHPQYKFAYDVQDSLSGDSKSQVEERDGDV-----VHGEYSLIDSDGYKRIVQYTSDPVNG 113
            |  |.:..|.|.:|..:.:..|...  |.|.|..     |.|.||....||.:..|.||:|. ||
  Fly    77 YNSDANGNYNFGFDTGNGIHRDETG--EFRGGWPHGSLGVQGSYSYTGDDGKQYTVNYTADK-NG 138

  Fly   114 FNAVVNRVPLDHVKTVVKTVAPVAVAAAP 142
            |:|....:|          |:| :|.|||
  Fly   139 FHAEGAHLP----------VSP-SVPAAP 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AfNP_649678.1 Chitin_bind_4 62..114 CDD:459790 18/56 (32%)
Cpr11BNP_572807.1 Chitin_bind_4 85..139 CDD:459790 18/56 (32%)

Return to query results.
Submit another query.