DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Af and Cpr31A

DIOPT Version :10

Sequence 1:NP_649678.1 Gene:Ccp84Af / 40820 FlyBaseID:FBgn0004778 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_995678.1 Gene:Cpr31A / 2768918 FlyBaseID:FBgn0053302 Length:340 Species:Drosophila melanogaster


Alignment Length:216 Identity:72/216 - (33%)
Similarity:92/216 - (42%) Gaps:79/216 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FAVLALISAASAGVLPVQQVYHAAPAVATYAQAPVAVAHAQPV---------------------- 48
            |::||:.::..||.......||  ||.||| |||.||.||.||                      
  Fly     9 FSLLAIAASCRAGFAATYAGYH--PAYATY-QAPAAVYHAAPVAQAAVYQQAAPVYAKTFVPAAP 70

  Fly    49 -----------LTKATE----------------------------------------EYDPHPQY 62
                       :.||..                                        |.:..|:|
  Fly    71 VYTRSYALPTPVVKAVAPAPLALPVAAPVVKTLAAAPVVAAPVVKTVAAAPAVLKQVELESSPRY 135

  Fly    63 KFAYDVQDSLSGDSKSQVEERDGDVVHGEYSLIDSDGYKRIVQYTSDPVNGFNAVVNRVPLDHVK 127
            .|:|.|.||::||.|||||.|||..|.|.||::|:||:||.|.||:|.:|||||||.|.|:...:
  Fly   136 DFSYGVHDSITGDIKSQVETRDGGNVVGSYSVLDADGFKRTVTYTADDINGFNAVVQREPVVAAR 200

  Fly   128 TVVKTVAPVAVAAAPIPVAYH 148
            .|   .|||...:||.||..|
  Fly   201 AV---AAPVVSVSAPAPVPVH 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AfNP_649678.1 Chitin_bind_4 62..114 CDD:459790 30/51 (59%)
Cpr31ANP_995678.1 Chitin_bind_4 135..187 CDD:459790 30/51 (59%)

Return to query results.
Submit another query.