DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Af and Cpr31A

DIOPT Version :9

Sequence 1:NP_649678.1 Gene:Ccp84Af / 40820 FlyBaseID:FBgn0004778 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_995678.1 Gene:Cpr31A / 2768918 FlyBaseID:FBgn0053302 Length:340 Species:Drosophila melanogaster


Alignment Length:216 Identity:72/216 - (33%)
Similarity:92/216 - (42%) Gaps:79/216 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FAVLALISAASAGVLPVQQVYHAAPAVATYAQAPVAVAHAQPV---------------------- 48
            |::||:.::..||.......||  ||.||| |||.||.||.||                      
  Fly     9 FSLLAIAASCRAGFAATYAGYH--PAYATY-QAPAAVYHAAPVAQAAVYQQAAPVYAKTFVPAAP 70

  Fly    49 -----------LTKATE----------------------------------------EYDPHPQY 62
                       :.||..                                        |.:..|:|
  Fly    71 VYTRSYALPTPVVKAVAPAPLALPVAAPVVKTLAAAPVVAAPVVKTVAAAPAVLKQVELESSPRY 135

  Fly    63 KFAYDVQDSLSGDSKSQVEERDGDVVHGEYSLIDSDGYKRIVQYTSDPVNGFNAVVNRVPLDHVK 127
            .|:|.|.||::||.|||||.|||..|.|.||::|:||:||.|.||:|.:|||||||.|.|:...:
  Fly   136 DFSYGVHDSITGDIKSQVETRDGGNVVGSYSVLDADGFKRTVTYTADDINGFNAVVQREPVVAAR 200

  Fly   128 TVVKTVAPVAVAAAPIPVAYH 148
            .|   .|||...:||.||..|
  Fly   201 AV---AAPVVSVSAPAPVPVH 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AfNP_649678.1 Chitin_bind_4 62..114 CDD:278791 30/51 (59%)
Cpr31ANP_995678.1 Chitin_bind_4 135..187 CDD:278791 30/51 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453230
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C9WU
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1544103at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.