DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Af and LOC1277342

DIOPT Version :10

Sequence 1:NP_649678.1 Gene:Ccp84Af / 40820 FlyBaseID:FBgn0004778 Length:151 Species:Drosophila melanogaster
Sequence 2:XP_316784.4 Gene:LOC1277342 / 1277342 VectorBaseID:AGAMI1_015005 Length:227 Species:Anopheles gambiae


Alignment Length:149 Identity:38/149 - (25%)
Similarity:58/149 - (38%) Gaps:37/149 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 FKFFAVLALISAASAGVLPVQQVYHAAPAVATYAQAPVAVAHAQPVLTKATEEYDP-HPQYKFAY 66
            |:|..:..|:.||:|   .....||..|..|.             :|::  :.|.. ..::..||
Mosquito     2 FRFVLLSTLLVAATA---QYNGGYHRDPKTAA-------------ILSE--QRYQSGDGKFGAAY 48

  Fly    67 DVQDSLSGDSKSQVEERDGDVVHGEYSLIDSDGYKRIVQYTSDPVNGFNAVVNRVPLDHVKTVVK 131
            ..:|..  |.|.:.:|:...  .|.||.:|..|.:|.:.|.:.. |||.|     ..||:     
Mosquito    49 TQEDGT--DFKEETDEQGNR--RGSYSYVDPTGQRRTISYVAGK-NGFQA-----SGDHL----- 98

  Fly   132 TVAPVAVAAAPIPVAYHQH 150
               |||..|.|.|....|:
Mosquito    99 ---PVAPPAPPQPAPQPQY 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AfNP_649678.1 Chitin_bind_4 62..114 CDD:459790 14/51 (27%)
LOC1277342XP_316784.4 Chitin_bind_4 47..91 CDD:459790 14/48 (29%)

Return to query results.
Submit another query.