DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Af and LOC1276668

DIOPT Version :10

Sequence 1:NP_649678.1 Gene:Ccp84Af / 40820 FlyBaseID:FBgn0004778 Length:151 Species:Drosophila melanogaster
Sequence 2:XP_316038.1 Gene:LOC1276668 / 1276668 VectorBaseID:AGAMI1_010311 Length:104 Species:Anopheles gambiae


Alignment Length:125 Identity:31/125 - (24%)
Similarity:44/125 - (35%) Gaps:30/125 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 AFKFFAVLALISAASAGVLPVQQVYHAAPAVATYAQAPVAVAHAQPVLTKATEEYDPHPQYKFAY 66
            |..|.||||:..||.|.....|        |..|....:.|                 ..|.|.|
Mosquito     4 AVVFAAVLAVALAAPADERDAQ--------VLKYENDNLGV-----------------DGYNFQY 43

  Fly    67 DVQDSLSGDSKSQVEERDGD----VVHGEYSLIDSDGYKRIVQYTSDPVNGFNAVVNRVP 122
            :..::::....::::....|    ||.|.||....||....|.|.:|. |||......:|
Mosquito    44 ETSNNINRAETAELKNFGDDVAALVVRGSYSYTGPDGQVYTVNYVADE-NGFQPEAPHIP 102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AfNP_649678.1 Chitin_bind_4 62..114 CDD:459790 15/55 (27%)
LOC1276668XP_316038.1 Chitin_bind_4 39..94 CDD:459790 15/55 (27%)

Return to query results.
Submit another query.