DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Af and Cpr56F

DIOPT Version :10

Sequence 1:NP_649678.1 Gene:Ccp84Af / 40820 FlyBaseID:FBgn0004778 Length:151 Species:Drosophila melanogaster
Sequence 2:XP_024667074.1 Gene:Cpr56F / 1271153 VectorBaseID:AGAMI1_009443 Length:181 Species:Anopheles gambiae


Alignment Length:76 Identity:26/76 - (34%)
Similarity:38/76 - (50%) Gaps:13/76 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 AHAQPVLTKATEEYDPHPQYKFAYDVQDSLSGDSKSQVEERDGDVVHGEYSLIDSDGYKRIVQYT 107
            |:.||.            :|.|.|:|||..||:....:|.||||...|.|.::..||.|::|.|.
Mosquito    91 ANVQPA------------KYSFEYNVQDFTSGNDFGHMESRDGDRTVGRYFVLLPDGRKQVVNYE 143

  Fly   108 SDPVNGFNAVV 118
            :|. ||:...:
Mosquito   144 ADQ-NGYRPTI 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AfNP_649678.1 Chitin_bind_4 62..114 CDD:459790 22/51 (43%)
Cpr56FXP_024667074.1 Chitin_bind_4 98..149 CDD:459790 22/51 (43%)

Return to query results.
Submit another query.