DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Ag and LOC4576703

DIOPT Version :10

Sequence 1:NP_649677.1 Gene:Ccp84Ag / 40819 FlyBaseID:FBgn0004777 Length:191 Species:Drosophila melanogaster
Sequence 2:XP_001237145.3 Gene:LOC4576703 / 4576703 VectorBaseID:AGAMI1_008684 Length:263 Species:Anopheles gambiae


Alignment Length:97 Identity:43/97 - (44%)
Similarity:60/97 - (61%) Gaps:11/97 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KFTILFAACIAVASAGIIPAAAPLAAVAQVEEYDPHPQYTYGYDVKDAISGDSKTQVETREGDVV 68
            |.||...|.:|||           .|..:.|:|..||.|.:.|.|||..:||.|:|.|.|:||||
Mosquito     3 KITIAALALLAVA-----------VAAYEHEDYHSHPSYKFEYGVKDPHTGDHKSQWEHRDGDVV 56

  Fly    69 QGQYSLNDADGYRRIVDYTADPINGFNAVVRR 100
            :|.|:|::|||.:|:|:|::|..|||.|.|:|
Mosquito    57 KGAYTLDEADGTKRVVEYSSDKHNGFQAHVKR 88

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AgNP_649677.1 Chitin_bind_4 42..94 CDD:459790 26/51 (51%)
LOC4576703XP_001237145.3 None

Return to query results.
Submit another query.