DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Ag and Cpr92A

DIOPT Version :9

Sequence 1:NP_649677.1 Gene:Ccp84Ag / 40819 FlyBaseID:FBgn0004777 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_650813.2 Gene:Cpr92A / 42333 FlyBaseID:FBgn0038714 Length:245 Species:Drosophila melanogaster


Alignment Length:243 Identity:92/243 - (37%)
Similarity:121/243 - (49%) Gaps:65/243 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LFAACIAVASAGII--------------------------PAAAPLAA--VAQVEEYDPHPQYTY 44
            |.:|.:.:|.||:|                          |...|..|  .|..|.|||.|:|::
  Fly     6 LLSAMLGIAYAGVIGPGPYYGGPAGPGPLHHYGGYAPQHGPLPGPYVAPKPAAPEPYDPDPKYSF 70

  Fly    45 GYDVKDAISGDSKTQVETREGDVVQGQYSLNDADGYRRIVDYTADPINGFNAVVRREP------- 102
            |||::|..:||.|:|.|||.||||:|.||:.|.||.:|.|||||||.:|||||||:||       
  Fly    71 GYDIQDGYTGDLKSQHETRHGDVVKGSYSVVDPDGTKRTVDYTADPHHGFNAVVRKEPLAYKAPA 135

  Fly   103 -LVAAVAAAPAAVVA----APAPVVRAAVAAPVV----------RAAPLTTTYAAAPAPLAYAAA 152
             |...||.|||.|.|    ||||.:.....||::          |.||     |.||.| |.|.|
  Fly   136 HLAPVVAPAPAPVPAHYGPAPAPPLPPVPKAPLLSYPLALGPYHRGAP-----APAPGP-APAPA 194

  Fly   153 PAPLAYAAPAPVVKAAPLVAAGPAIVKTQFA---------SPLISYAY 191
            |||::.....||:.:|...||.||:..:.:|         :|:..:||
  Fly   195 PAPVSVPVATPVLPSAHFHAAYPALAHSPYAHYPAPGPAPAPVEPHAY 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AgNP_649677.1 Chitin_bind_4 42..94 CDD:278791 30/51 (59%)
Cpr92ANP_650813.2 PHA03185 <21..77 CDD:177553 13/55 (24%)
Chitin_bind_4 68..120 CDD:278791 30/51 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C9WU
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D147941at6960
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.