DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Ag and Ccp84Af

DIOPT Version :9

Sequence 1:NP_649677.1 Gene:Ccp84Ag / 40819 FlyBaseID:FBgn0004777 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_649678.1 Gene:Ccp84Af / 40820 FlyBaseID:FBgn0004778 Length:151 Species:Drosophila melanogaster


Alignment Length:148 Identity:81/148 - (54%)
Similarity:96/148 - (64%) Gaps:30/148 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAFKFTILFA--ACIAVASAGIIP--------------AAAPLA-AVAQ------VEEYDPHPQY 42
            |||||   ||  |.|:.||||::|              |.||:| |.||      .|||||||||
  Fly     1 MAFKF---FAVLALISAASAGVLPVQQVYHAAPAVATYAQAPVAVAHAQPVLTKATEEYDPHPQY 62

  Fly    43 TYGYDVKDAISGDSKTQVETREGDVVQGQYSLNDADGYRRIVDYTADPINGFNAVVRREPL---- 103
            .:.|||:|::|||||:|||.|:||||.|:|||.|:|||:|||.||:||:|||||||.|.||    
  Fly    63 KFAYDVQDSLSGDSKSQVEERDGDVVHGEYSLIDSDGYKRIVQYTSDPVNGFNAVVNRVPLDHVK 127

  Fly   104 VAAVAAAPAAVVAAPAPV 121
            ......||.||.|||.||
  Fly   128 TVVKTVAPVAVAAAPIPV 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AgNP_649677.1 Chitin_bind_4 42..94 CDD:278791 34/51 (67%)
Ccp84AfNP_649678.1 Chitin_bind_4 62..114 CDD:278791 34/51 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440159
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C9WU
Homologene 1 1.000 - - H43711
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D133302at33392
OrthoFinder 1 1.000 - - FOG0006710
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.