powered by:
Protein Alignment Ccp84Ag and Cpr76Bb
DIOPT Version :9
Sequence 1: | NP_649677.1 |
Gene: | Ccp84Ag / 40819 |
FlyBaseID: | FBgn0004777 |
Length: | 191 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_649121.1 |
Gene: | Cpr76Bb / 40121 |
FlyBaseID: | FBgn0036879 |
Length: | 198 |
Species: | Drosophila melanogaster |
Alignment Length: | 69 |
Identity: | 38/69 - (55%) |
Similarity: | 54/69 - (78%) |
Gaps: | 2/69 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 34 EEYDPH--PQYTYGYDVKDAISGDSKTQVETREGDVVQGQYSLNDADGYRRIVDYTADPINGFNA 96
::::|| |:|.:.|.||||.:||.|:|.|||:||.|:|.|||.::||..|:|:||||..|||||
Fly 76 DKHEPHHYPKYQFDYGVKDAHTGDQKSQWETRDGDKVKGSYSLKESDGTTRVVEYTADDHNGFNA 140
Fly 97 VVRR 100
||::
Fly 141 VVKK 144
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_2C9WU |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR12236 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.910 |
|
Return to query results.
Submit another query.