DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Ag and Cpr76Ba

DIOPT Version :9

Sequence 1:NP_649677.1 Gene:Ccp84Ag / 40819 FlyBaseID:FBgn0004777 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_649120.1 Gene:Cpr76Ba / 40120 FlyBaseID:FBgn0036878 Length:204 Species:Drosophila melanogaster


Alignment Length:157 Identity:50/157 - (31%)
Similarity:66/157 - (42%) Gaps:58/157 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAFKFTILFAACIAVASAGIIPAA----------------------------------------- 24
            ||.:.:||..|.:.||:|..||..                                         
  Fly     1 MAHQLSILCCALLGVAAASYIPHGGYSHEHGVGYSIQTHHEAPKQWQDHHQAHHQWVDVPKAHSW 65

  Fly    25 -----------APLAA------VAQVEEYDPHPQYTYGYDVKDAISGDSKTQVETREGDVVQGQY 72
                       ||:||      .:..||...||:|.:.|.|||..:||.|.|.|||:||.|:|.|
  Fly    66 GTVQDHHHQQWAPVAAHDSHHQWSHHEEPKHHPKYEFNYGVKDTKTGDIKQQWETRDGDKVKGGY 130

  Fly    73 SLNDADGYRRIVDYTADPINGFNAVVR 99
            ::.:|||..|||:||||..|||.|.|:
  Fly   131 TMKEADGRTRIVEYTADSHNGFQATVK 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AgNP_649677.1 Chitin_bind_4 42..94 CDD:278791 28/51 (55%)
Cpr76BaNP_649120.1 Chitin_bind_4 100..152 CDD:278791 28/51 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C9WU
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.